ATP5H_HUMAN   O75947


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75947

Recommended name:ATP synthase subunit d, mitochondrial

EC number:

Alternative names:(ATPase subunit d) (ATP synthase peripheral stalk subunit d)

Cleaved into:

GeneID:10476

Gene names  (primary ):ATP5PD

Gene names  (synonym ):ATP5H

Gene names  (ORF ):My032

Length:161

Mass:18491

Sequence:MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

Tissue specificity:

Induction:

Developmental stage:

Protein families:ATPase d subunit family


   💬 WhatsApp