ATP5S_HUMAN   Q99766


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99766

Recommended name:ATP synthase subunit s, mitochondrial

EC number:

Alternative names:(ATP synthase-coupling factor B) (FB) (Distal membrane arm assembly complex 2-like protein) (Mitochondrial ATP synthase regulatory component factor B)

Cleaved into:

GeneID:27109

Gene names  (primary ):DMAC2L

Gene names  (synonym ):ATP5S ATPW

Gene names  (ORF ):

Length:215

Mass:24866

Sequence:MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK

Tissue specificity:

Induction:

Developmental stage:

Protein families:ATP synthase subunit s family


   💬 WhatsApp