ZFAN6_HUMAN Q6FIF0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6FIF0
Recommended name：AN1-type zinc finger protein 6
EC number：
Alternative names：(Associated with PRK1 protein) (Zinc finger A20 domain-containing protein 3)
Cleaved into：
GeneID：54469
Gene names (primary )：ZFAND6
Gene names (synonym )：AWP1 ZA20D3
Gene names (ORF )：HT032
Length：208
Mass：22555
Sequence：MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI
Tissue specificity：Widely expressed with high level in heart, skeletal muscle, liver, kidney and placenta. {ECO:0000269|PubMed:11054541}.
Induction：
Developmental stage：
Protein families：