GADL1_HUMAN   Q6ZQY3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6ZQY3

Recommended name:Acidic amino acid decarboxylase GADL1

EC number:EC:4.1.1.11

Alternative names:(Aspartate 1-decarboxylase) (ADC) (HuADC) (Cysteine sulfinic acid decarboxylase) (CSADC) (HuCSADC) (Glutamate decarboxylase-like protein 1)

Cleaved into:

GeneID:339896

Gene names  (primary ):GADL1

Gene names  (synonym ):

Gene names  (ORF ):

Length:521

Mass:59246

Sequence:MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEVVLKATDVNEKVCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQLYAGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGGSVSNMYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHVDASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLVDEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM

Tissue specificity:Expressed very weakly in neurons and not detected in astrocytes, brain or liver. {ECO:0000269|PubMed:26327310}.

Induction:

Developmental stage:

Protein families:Group II decarboxylase family


   💬 WhatsApp