CI037_HUMAN   Q9H2J1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H2J1

Recommended name:Uncharacterized protein ARRDC1-AS1

EC number:

Alternative names:(ARRDC1 antisense RNA 1) (ARRDC1 antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):ARRDC1-AS1

Gene names  (synonym ):C9orf37

Gene names  (ORF ):AD038

Length:176

Mass:18048

Sequence:MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp