ARPC3_HUMAN   O15145


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O15145

Recommended name:Actin-related protein 2/3 complex subunit 3

EC number:

Alternative names:(Arp2/3 complex 21 kDa subunit) (p21-ARC)

Cleaved into:

GeneID:10094

Gene names  (primary ):ARPC3

Gene names  (synonym ):ARC21

Gene names  (ORF ):

Length:178

Mass:20547

Sequence:MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:ARPC3 family


   💬 WhatsApp