ARPC5_HUMAN   O15511


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O15511

Recommended name:Actin-related protein 2/3 complex subunit 5

EC number:

Alternative names:(Arp2/3 complex 16 kDa subunit) (p16-ARC)

Cleaved into:

GeneID:10092

Gene names  (primary ):ARPC5

Gene names  (synonym ):ARC16

Gene names  (ORF ):

Length:151

Mass:16320

Sequence:MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV

Tissue specificity:

Induction:

Developmental stage:

Protein families:ARPC5 family


   💬 WhatsApp