AQP9_HUMAN   O43315


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43315

Recommended name:Aquaporin-9

EC number:

Alternative names:(AQP-9) (Aquaglyceroporin-9) (Small solute channel 1)

Cleaved into:

GeneID:366

Gene names  (primary ):AQP9

Gene names  (synonym ):SSC1

Gene names  (ORF ):

Length:295

Mass:31431

Sequence:MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM

Tissue specificity:Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen. {ECO:0000269|PubMed:10564231, ECO:0000269|PubMed:9514918}.

Induction:

Developmental stage:

Protein families:MIP/aquaporin (TC 1.A.8) family


   💬 WhatsApp