AQP10_HUMAN Q96PS8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96PS8
Recommended name：Aquaporin-10
EC number：
Alternative names：(AQP-10) (Aquaglyceroporin-10) (Small intestine aquaporin)
Cleaved into：
GeneID：89872
Gene names (primary )：AQP10
Gene names (synonym )：
Gene names (ORF )：
Length：301
Mass：31763
Sequence：MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
Tissue specificity：Detected in epithelial cells on villi in the ileum, and also in stomach, jejunum, colon, rectum, white adipose tissue and placenta (at protein level) (PubMed:15221416, PubMed:23382902). Expressed in duodenum and jejunum. Highest expression in absorptive epithelial cells at the tips of villi in the jejunum (PubMed:11573934, PubMed:12084581). Detected in subcutaneous adipose tissue (PubMed:23382902). {ECO:0000269|PubMed:11573934, ECO:0000269|PubMed:12084581, ECO:0000269|PubMed:15221416, ECO:0000269|PubMed:23382902}.
Induction：
Developmental stage：
Protein families：MIP/aquaporin (TC 1.A.8) family