MIC26_HUMAN Q9BUR5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BUR5
Recommended name：MICOS complex subunit MIC26
EC number：
Alternative names：(Apolipoprotein O) (MICOS complex subunit MIC23) (Protein FAM121B)
Cleaved into：
GeneID：79135
Gene names (primary )：APOO
Gene names (synonym )：FAM121B MIC23 MIC26
Gene names (ORF )：My025 UNQ1866/PRO4302
Length：198
Mass：22285
Sequence：MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
Tissue specificity：Expressed in all tissues examined. Up-regulated in diabetic heart. {ECO:0000269|PubMed:16956892}.
Induction：
Developmental stage：
Protein families：Apolipoprotein O/MICOS complex subunit Mic27 family