APC11_HUMAN Q9NYG5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NYG5
Recommended name:Anaphase-promoting complex subunit 11
EC number:
Alternative names:(APC11) (Cyclosome subunit 11) (Hepatocellular carcinoma-associated RING finger protein)
Cleaved into:
GeneID:51529
Gene names (primary ):ANAPC11
Gene names (synonym ):
Gene names (ORF ):HSPC214
Length:84
Mass:9841
Sequence:MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Tissue specificity:Expressed at high levels in skeletal muscle and heart; in moderate levels in brain, kidney, and liver; and at low levels in colon, thymus, spleen, small intestine, placenta, lung and peripheral blood leukocyte. {ECO:0000269|PubMed:11573242}.
Induction:
Developmental stage:
Protein families:RING-box family