FHIT_HUMAN P49789
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49789
Recommended name：Bis(5'-adenosyl)-triphosphatase
EC number：EC:3.6.1.29
Alternative names：(AP3A hydrolase) (AP3Aase) (Adenosine 5'-monophosphoramidase FHIT(EC:3.9.1.-) (Adenylylsulfatase(EC:3.6.2.1)) (Adenylylsulfate-ammonia adenylyltransferase(EC:2.7.7.51)) (Diadenosine 5',5'''-P1,P3-triphosphate hydrolase) (Dinucleosidetriphosphatase) (Fragile histidine triad protein)
Cleaved into：
GeneID：2272
Gene names (primary )：FHIT
Gene names (synonym )：
Gene names (ORF )：
Length：147
Mass：16858
Sequence：MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ
Tissue specificity：Low levels expressed in all tissues tested. Phospho-FHIT observed in liver and kidney, but not in brain and lung. Phospho-FHIT undetected in all tested human tumor cell lines.
Induction：
Developmental stage：
Protein families：