AP3S1_HUMAN Q92572
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q92572
Recommended name：AP-3 complex subunit sigma-1
EC number：
Alternative names：(AP-3 complex subunit sigma-3A) (Adaptor-related protein complex 3 subunit sigma-1) (Clathrin-associated/assembly/adaptor protein, small 3) (Sigma-3A-adaptin) (Sigma3A-adaptin) (Sigma-adaptin 3a)
Cleaved into：
GeneID：1176
Gene names (primary )：AP3S1
Gene names (synonym )：CLAPS3
Gene names (ORF )：
Length：193
Mass：21732
Sequence：MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVLETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK
Tissue specificity：Present in all adult tissues examined. {ECO:0000269|PubMed:8697810, ECO:0000269|PubMed:9118953, ECO:0000269|PubMed:9151686}.
Induction：
Developmental stage：
Protein families：Adaptor complexes small subunit family