ASF1B_HUMAN   Q9NVP2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NVP2

Recommended name:Histone chaperone ASF1B

EC number:

Alternative names:(Anti-silencing function protein 1 homolog B) (hAsf1) (hAsf1b) (CCG1-interacting factor A-II) (CIA-II) (hCIA-II)

Cleaved into:

GeneID:55723

Gene names  (primary ):ASF1B

Gene names  (synonym ):

Gene names  (ORF ):

Length:202

Mass:22434

Sequence:MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI

Tissue specificity:Highly expressed in testis and at lower levels in colon, small intestine and thymus. {ECO:0000269|PubMed:12842904}.

Induction:

Developmental stage:

Protein families:ASF1 family


   💬 WhatsApp