GP15L_HUMAN Q6UWK7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6UWK7
Recommended name：Protein GPR15L
EC number：
Alternative names：(Antimicrobial peptide with 57 amino acid residues) (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Secreted protein C10orf99)
Cleaved into：
GeneID：387695
Gene names (primary )：GPR15L
Gene names (synonym )：C10orf99
Gene names (ORF )：UNQ1833/PRO3446
Length：81
Mass：9173
Sequence：MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV
Tissue specificity：Expressed at high levels in colon, and cervix and at moderate level in tonsil (PubMed:25585381, PubMed:28900043). Highly reduced expression in primary colon cancer tissues compared with that in adjacent tissues (PubMed:25351403). Highest levels of expression detected in stomach and colon; expressed in epithelium of skin and esophagus, and in some tumor and/or tumor adjacent tissues (TAT), including TAT of esophagus cancer, hepatocellular carcinoma (HCC), squamous cell carcinoma (SCC), basal cell carcinoma (BCC) and invasive ductal carcinoma (IDC) tissues (at protein level) (PubMed:25585381). {ECO:0000269|PubMed:25585381, ECO:0000269|PubMed:28900043}.
Induction：
Developmental stage：
Protein families：