DANCR_HUMAN P0C864
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0C864
Recommended name：Putative uncharacterized protein DANCR
EC number：
Alternative names：(Anti-differentiation ncRNA protein) (Differentiation antagonizing non-protein coding RNA) (Small nucleolar RNA host gene protein 13)
Cleaved into：
GeneID：
Gene names (primary )：DANCR
Gene names (synonym )：ANCR KIAA0114 SNHG13
Gene names (ORF )：
Length：163
Mass：16785
Sequence：MAGPVPPHPGLAVRAAALHPAPLRIFPGLAELPDLSRGSAARPALAQSLPGIGCGPRDPPASLPAPRRLSGLCARRRSQASLSAGVARADAPLCSGFRAGHACGTGTQPQPTLSSRSSSLTSAEVQLPQFLAQVDNYRHKPLKLECPVAGISIDLSQLSLQLQ
Tissue specificity：Expressed in keratinocytes. {ECO:0000269|PubMed:22302877}.
Induction：
Developmental stage：
Protein families：