ANXA9_HUMAN   O76027


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O76027

Recommended name:Annexin A9

EC number:

Alternative names:(Annexin XXXI) (Annexin-31) (Annexin-9) (Pemphaxin)

Cleaved into:

GeneID:8416

Gene names  (primary ):ANXA9

Gene names  (synonym ):ANX31

Gene names  (ORF ):

Length:345

Mass:38364

Sequence:MSVTGGKMAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAEGPSREETWVPVFTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQVALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM

Tissue specificity:Expressed in the stratified squamous skin epithelium, but not in epithelia of other types (at protein level). {ECO:0000269|PubMed:10899159}.

Induction:

Developmental stage:

Protein families:Annexin family


   💬 WhatsApp