A20A5_HUMAN   A0PJZ0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0PJZ0

Recommended name:Putative ankyrin repeat domain-containing protein 20A5

EC number:

Alternative names:(Ankyrin repeat domain-containing protein 20A5 pseudogene)

Cleaved into:

GeneID:

Gene names  (primary ):ANKRD20A5P

Gene names  (synonym ):ANKRD20A5

Gene names  (ORF ):

Length:165

Mass:18446

Sequence:MKLFGFRSRRGQTVLGSIDHLYTGSGYRIRYSELQKIHKAAVKGDAAEMERCLARRSGDLDALDKQHRTALHLACASGHVKVVTLLVNRKCQIDIYDKENRTPLIQAVHCQEEACAVILLEHGANPNLKDIYGNTALHYAVYSESTSLAEKLLFHGENIEALDKV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp