STXB6_HUMAN   Q8NFX7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NFX7

Recommended name:Syntaxin-binding protein 6

EC number:

Alternative names:(Amisyn)

Cleaved into:

GeneID:29091

Gene names  (primary ):STXBP6

Gene names  (synonym ):

Gene names  (ORF ):HSPC156

Length:210

Mass:23554

Sequence:MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLKNSAQQFAETAHKLAMKHKC

Tissue specificity:Detected at low levels in brain, and at very low levels in heart, adrenal gland, testis, liver and kidney. {ECO:0000269|PubMed:12145319}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp