ADML_HUMAN   P35318


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35318

Recommended name:Pro-adrenomedullin [Cleaved into: Adrenomedullin

EC number:

Alternative names:(AM); Proadrenomedullin N-20 terminal peptide(ProAM N-terminal 20 peptide) (PAMP) (ProAM-N20)]

Cleaved into:Adrenomedullin (AM); Proadrenomedullin N-20 terminal peptide (ProAM N-terminal 20 peptide) (PAMP) (ProAM-N20)

GeneID:133

Gene names  (primary ):ADM

Gene names  (synonym ):AM

Gene names  (ORF ):

Length:185

Mass:20420

Sequence:MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL

Tissue specificity:Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues.

Induction:

Developmental stage:

Protein families:Adrenomedullin family


   💬 WhatsApp