ULBP3_HUMAN   Q9BZM4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BZM4

Recommended name:UL16-binding protein 3

EC number:

Alternative names:(ALCAN-gamma) (NKG2D ligand 3) (N2DL-3) (NKG2DL3) (Retinoic acid early transcript 1N)

Cleaved into:

GeneID:79465

Gene names  (primary ):ULBP3

Gene names  (synonym ):N2DL3 RAET1N

Gene names  (ORF ):

Length:244

Mass:27949

Sequence:MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAPGLAQPKAIATTLSPWSFLIILCFILPGI

Tissue specificity:

Induction:

Developmental stage:

Protein families:MHC class I family


   💬 WhatsApp