EFNA5_HUMAN   P52803


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P52803

Recommended name:Ephrin-A5

EC number:

Alternative names:(AL-1) (EPH-related receptor tyrosine kinase ligand 7) (LERK-7)

Cleaved into:

GeneID:1946

Gene names  (primary ):EFNA5

Gene names  (synonym ):EPLG7 LERK7

Gene names  (ORF ):

Length:228

Mass:26297

Sequence:MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ephrin family


   💬 WhatsApp