AIF1_HUMAN   P55008


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P55008

Recommended name:Allograft inflammatory factor 1

EC number:

Alternative names:(AIF-1) (Ionized calcium-binding adapter molecule 1) (Protein G1)

Cleaved into:

GeneID:199

Gene names  (primary ):AIF1

Gene names  (synonym ):G1 IBA1

Gene names  (ORF ):

Length:147

Mass:16703

Sequence:MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Tissue specificity:Detected in T-lymphocytes and peripheral blood mononuclear cells. {ECO:0000269|PubMed:16049345}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp