PXL2C_HUMAN   Q7RTV5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7RTV5

Recommended name:Peroxiredoxin-like 2C

EC number:

Alternative names:(AhpC/TSA antioxidant enzyme domain-containing protein 1) (Thioredoxin-like protein AAED1)

Cleaved into:

GeneID:195827

Gene names  (primary ):PRXL2C

Gene names  (synonym ):AAED1 C9orf21

Gene names  (ORF ):

Length:226

Mass:24857

Sequence:MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVVVFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTLILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV

Tissue specificity:Expressed in gastric tissues. {ECO:0000269|PubMed:29901208}.

Induction:

Developmental stage:

Protein families:Peroxiredoxin-like PRXL2 family, PRXL2C subfamily


   💬 WhatsApp