S10AG_HUMAN   Q96FQ6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96FQ6

Recommended name:Protein S100-A16

EC number:

Alternative names:(Aging-associated gene 13 protein) (Protein S100-F) (S100 calcium-binding protein A16)

Cleaved into:

GeneID:140576

Gene names  (primary ):S100A16

Gene names  (synonym ):S100F

Gene names  (ORF ):AAG13

Length:103

Mass:11801

Sequence:MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS

Tissue specificity:Ubiquitous (PubMed:14684152). Highly expressed in esophagus, adipose tissues and colon. Expressed at lower level in lung, brain, pancreas and skeletal muscle. Expression is up-regulated in tumors of bladder, lung, thyroid gland, pancreas and ovary (PubMed:14684152). Expressed in astrocytes (PubMed:17030513). {ECO:0000269|PubMed:14684152, ECO:0000269|PubMed:17030513}.

Induction:

Developmental stage:

Protein families:S-100 family


   💬 WhatsApp