FDX2_HUMAN Q6P4F2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6P4F2
Recommended name:Ferredoxin-2, mitochondrial
EC number:
Alternative names:(Adrenodoxin-like protein) (Ferredoxin-1-like protein)
Cleaved into:
GeneID:112812
Gene names (primary ):FDX2
Gene names (synonym ):FDX1L
Gene names (ORF ):
Length:186
Mass:19888
Sequence:MHVMAASMARGGVSARVLLQAARGTWWNRPGGTSGSGEGVALGTTRKFQATGSRPAGEEDAGGPERPGDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH
Tissue specificity:Widely expressed, with highest levels in testis, kidney and brain (at protein level) (PubMed:20547883). Expressed in muscle (at protein level) (PubMed:24281368, PubMed:30010796). Expressed in fibroblasts (at protein level) (PubMed:24281368). {ECO:0000269|PubMed:20547883, ECO:0000269|PubMed:24281368, ECO:0000269|PubMed:30010796}.
Induction:
Developmental stage:
Protein families:Adrenodoxin/putidaredoxin family