AAS1_HUMAN   P86434


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P86434

Recommended name:Putative uncharacterized protein ADORA2A-AS1

EC number:

Alternative names:(ADORA2A antisense RNA 1) (ADORA2A antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):ADORA2A-AS1

Gene names  (synonym ):C22orf45

Gene names  (ORF ):

Length:159

Mass:17238

Sequence:MEQDWQPGEEVTPGPEPCSKGQAPLYPIVHVTELKHTDPNFPSNSNAVGTSSGWNRIGTGCSHTWDWRFSCTQQALLPLLGAWEWSIDTEAGGGRREQSQKPCSNGGPAAAGEGRVLPSPCFPWSTCQAAIHKVCRWQGCTRPALLAPSLATLKEHSYP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp