AAMDC_HUMAN   Q9H7C9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H7C9

Recommended name:Mth938 domain-containing protein

EC number:

Alternative names:(Adipogenesis associated Mth938 domain-containing protein)

Cleaved into:

GeneID:28971

Gene names  (primary ):AAMDC

Gene names  (synonym ):C11orf67

Gene names  (ORF ):PTD015

Length:122

Mass:13332

Sequence:MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC

Tissue specificity:

Induction:

Developmental stage:

Protein families:AAMDC family


   💬 WhatsApp