A4AS1_HUMAN   Q5T5F5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5T5F5

Recommended name:Uncharacterized protein ADAMTSL4-AS1

EC number:

Alternative names:(ADAMTSL4 antisense RNA 1) (ADAMTSL4 antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):ADAMTSL4-AS1

Gene names  (synonym ):C1orf138

Gene names  (ORF ):

Length:129

Mass:14090

Sequence:MWLWQDIQCCPAPPSAPPRALEPGRAPPPPGEGLGAGIPSLSPPQKKPQSVGICVRQKGRQKAGLEKGNRKKELRQANCPSLRPQRKGADTRRLPRETRPTKKRTAAAQPFLQLWNPAPHTSNGRTGDL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp