S35G5_HUMAN   Q96KT7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96KT7

Recommended name:Solute carrier family 35 member G5

EC number:

Alternative names:(Acyl-malonyl-condensing enzyme 1-like protein 2)

Cleaved into:

GeneID:83650

Gene names  (primary ):SLC35G5

Gene names  (synonym ):AMAC AMAC1L2

Gene names  (ORF ):

Length:338

Mass:35161

Sequence:MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGATNGLLVALLGGGLPAGFVGPLSRMAYQGSNLPSLELLICRCLFHLPIALLLKLRGDPLLGPPDIRGWACFCALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTVCSAVLTLCLESQGLGGYEWCGLLGSILGLIIILGPGLWTLQEGTTGVYTTLGYVQAFLGGLALSLGLLVYRSLHFPSCLPTVAFLSGLVGLLGCVPGLFVLQTPVLPSDLLSWSCVGAEGILALVSFTCVGYAVTKAHPALVCAVLHSEVVVALILQYYMLHETVALSDIMGAGVVLGSIAIITARNLSCERTGKVEE

Tissue specificity:Expressed in placenta and testis. {ECO:0000269|PubMed:17101974}.

Induction:

Developmental stage:

Protein families:SLC35G solute transporter family


   💬 WhatsApp