CLC2B_HUMAN   Q92478


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q92478

Recommended name:C-type lectin domain family 2 member B

EC number:

Alternative names:(Activation-induced C-type lectin) (C-type lectin superfamily member 2) (IFN-alpha-2b-inducing-related protein 1)

Cleaved into:

GeneID:9976

Gene names  (primary ):CLEC2B

Gene names  (synonym ):AICL CLECSF2 IFNRG1

Gene names  (ORF ):

Length:149

Mass:17307

Sequence:MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIH

Tissue specificity:Expressed preferentially in lymphoid tissues, and in most hematopoietic cell types.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp