MEDAG_HUMAN   Q5VYS4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5VYS4

Recommended name:Mesenteric estrogen-dependent adipogenesis protein

EC number:

Alternative names:(Activated in W/Wv mouse stomach 3 homolog) (hAWMS3) (Mesenteric estrogen-dependent adipose 4) (MEDA-4)

Cleaved into:

GeneID:84935

Gene names  (primary ):MEDAG

Gene names  (synonym ):AWMS3 C13orf33 MEDA4

Gene names  (ORF ):

Length:303

Mass:34190

Sequence:MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVARPGEPAAARGGFNVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGLSNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLTEPLLAELPFPSVLESEETPNQFI

Tissue specificity:Highly expressed in the visceral fat depot. {ECO:0000269|PubMed:22510272}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp