ABITM_HUMAN   Q9NX38


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NX38

Recommended name:Protein Abitram

EC number:

Alternative names:(Actin-binding transcription modulator) (Protein Simiate)

Cleaved into:

GeneID:54942

Gene names  (primary ):ABITRAM

Gene names  (synonym ):C9orf6 FAM206A

Gene names  (ORF ):

Length:181

Mass:20378

Sequence:MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQISTNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS

Tissue specificity:

Induction:

Developmental stage:

Protein families:ABITRAM family


   💬 WhatsApp