ACBP_HUMAN   P07108


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P07108

Recommended name:Acyl-CoA-binding protein

EC number:

Alternative names:(ACBP) (Diazepam-binding inhibitor) (DBI) (Endozepine) (EP)

Cleaved into:

GeneID:1622

Gene names  (primary ):DBI

Gene names  (synonym ):

Gene names  (ORF ):

Length:87

Mass:10044

Sequence:MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Tissue specificity:Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart. {ECO:0000269|PubMed:16055366, ECO:0000269|PubMed:21698759}.

Induction:

Developmental stage:

Protein families:ACBP family


   💬 WhatsApp