AB17B_HUMAN   Q5VST6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5VST6

Recommended name:Alpha/beta hydrolase domain-containing protein 17B

EC number:EC:3.1.2.22

Alternative names:(Abhydrolase domain-containing protein 17B)

Cleaved into:

GeneID:51104

Gene names  (primary ):ABHD17B

Gene names  (synonym ):C9orf77 FAM108B1

Gene names  (ORF ):CGI-67

Length:288

Mass:32215

Sequence:MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFMTRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYCFDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQFVSQELVNL

Tissue specificity:

Induction:

Developmental stage:

Protein families:AB hydrolase superfamily, ABHD17 family


   💬 WhatsApp