R13P3_HUMAN Q6NVV1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6NVV1
Recommended name:Putative ribosomal protein uL13-like
EC number:
Alternative names:(60S ribosomal protein L13a pseudogene 3) (Putative 60S ribosomal protein L13a protein RPL13AP3)
Cleaved into:
GeneID:
Gene names (primary ):RPL13AP3
Gene names (synonym ):
Gene names (ORF ):
Length:102
Mass:12135
Sequence:MLRHKTKRGHASLDCLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFALLGRQAQEVRWKYQAVTATLEEKRKEKAKIHYWKKKQLMRLRKQAEKNVKKN
Tissue specificity:
Induction:
Developmental stage:
Protein families:Universal ribosomal protein uL13 family