ATP68_HUMAN   P56378


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56378

Recommended name:ATP synthase F(0) complex subunit j, mitochondrial

EC number:

Alternative names:(6.8 kDa mitochondrial proteolipid protein) (MLQ) (ATP synthase membrane subunit 6.8PL)

Cleaved into:

GeneID:9556

Gene names  (primary ):ATP5MPL

Gene names  (synonym ):C14orf2 MP68

Gene names  (ORF ):PRO1574

Length:58

Mass:6662

Sequence:MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small mitochondrial proteolipid family


   💬 WhatsApp