4EBP3_HUMAN O60516
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O60516
Recommended name:Eukaryotic translation initiation factor 4E-binding protein 3
EC number:
Alternative names:(4E-BP3) (eIF4E-binding protein 3)
Cleaved into:
GeneID:8637
Gene names (primary ):EIF4EBP3
Gene names (synonym ):
Gene names (ORF ):
Length:100
Mass:10873
Sequence:MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
Tissue specificity:Expression is highest in skeletal muscle, heart, kidney, and pancreas, whereas there is very little expression in brain and thymus. {ECO:0000269|PubMed:9593750}.
Induction:
Developmental stage:
Protein families:EIF4E-binding protein family