RTP3_HUMAN Q9BQQ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BQQ7
Recommended name：Receptor-transporting protein 3
EC number：
Alternative names：(3CxxC-type zinc finger protein 3) (Transmembrane protein 7)
Cleaved into：
GeneID：83597
Gene names (primary )：RTP3
Gene names (synonym )：TMEM7 Z3CXXC3
Gene names (ORF )：
Length：232
Mass：27031
Sequence：MAGDTEVWKQMFQELMREVKPWHRWTLRPDKGLLPNVLKPGWMQYQQWTFARFQCSSCSRNWASAQVLVLFHMNWSEEKSRGQVKMRVFTQRCKKCPQPLFEDPEFTQENISRILKNLVFRILKKCYRGRFQLIEEVPMIKDISLEGPHNSDNCEACLQGFCAGPIQVTSLPPSQTPRVHSIYKVEEVVKPWASGENVYSYACQNHICRNLSIFCCCVILIVIVVIVVKTAI
Tissue specificity：Expressed predominantly in adult liver (PubMed:11896456, PubMed:17693185). Expressed in testis (PubMed:16720576, PubMed:17693185). Also expressed in kidney, lung and fetal liver (PubMed:17693185). Low levels in heart, thyroid, adrenal gland, pancreas, ovary, prostate, skin, plasma leukocytes, bone marrow and fetal brain (PubMed:17693185). Not detected in brain, spleen, colon, small intestine, skeletal muscle, stomach, placenta, salivary gland and uterus (PubMed:17693185). {ECO:0000269|PubMed:11896456, ECO:0000269|PubMed:16720576, ECO:0000269|PubMed:17693185}.
Induction：
Developmental stage：
Protein families：TMEM7 family