RTP1_HUMAN   P59025


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P59025

Recommended name:Receptor-transporting protein 1

EC number:

Alternative names:(3CxxC-type zinc finger protein 1)

Cleaved into:

GeneID:132112

Gene names  (primary ):RTP1

Gene names  (synonym ):Z3CXXC1

Gene names  (ORF ):

Length:263

Mass:30913

Sequence:MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTKSQDQTGSGWNFCSIPWCLFWATVLLLIIYLQFSFRSSV

Tissue specificity:Expressed in testis. {ECO:0000269|PubMed:16720576}.

Induction:

Developmental stage:

Protein families:TMEM7 family


   💬 WhatsApp