FCN2_HUMAN   Q15485


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15485

Recommended name:Ficolin-2

EC number:

Alternative names:(37 kDa elastin-binding protein) (Collagen/fibrinogen domain-containing protein 2) (EBP-37) (Ficolin-B) (Ficolin-beta) (Hucolin) (L-ficolin) (Serum lectin p35)

Cleaved into:

GeneID:2220

Gene names  (primary ):FCN2

Gene names  (synonym ):FCNL

Gene names  (ORF ):

Length:313

Mass:34001

Sequence:MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA

Tissue specificity:Expressed by the liver and secreted in plasma.

Induction:

Developmental stage:

Protein families:Ficolin lectin family


   💬 WhatsApp