PM34_HUMAN   O43808


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43808

Recommended name:Peroxisomal membrane protein PMP34

EC number:

Alternative names:(34 kDa peroxisomal membrane protein) (Solute carrier family 25 member 17)

Cleaved into:

GeneID:10478

Gene names  (primary ):SLC25A17

Gene names  (synonym ):PMP34

Gene names  (ORF ):

Length:307

Mass:34567

Sequence:MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKRAHQH

Tissue specificity:Ubiquitous. Expressed in liver. {ECO:0000269|PubMed:22185573}.

Induction:

Developmental stage:

Protein families:Mitochondrial carrier (TC 2.A.29) family


   💬 WhatsApp