CHCH1_HUMAN   Q96BP2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96BP2

Recommended name:Small ribosomal subunit protein mS37

EC number:

Alternative names:(28S ribosomal protein S37, mitochondrial) (MRP-S37) (Coiled-coil-helix-coiled-coil-helix domain-containing protein 1) (Nuclear protein C2360)

Cleaved into:

GeneID:118487

Gene names  (primary ):CHCHD1

Gene names  (synonym ):C10orf34 MRPS37

Gene names  (ORF ):

Length:118

Mass:13475

Sequence:MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrion-specific ribosomal protein mS37 family


   💬 WhatsApp