PXMP4_HUMAN Q9Y6I8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y6I8
Recommended name:Peroxisomal membrane protein 4
EC number:
Alternative names:(24 kDa peroxisomal intrinsic membrane protein)
Cleaved into:
GeneID:11264
Gene names (primary ):PXMP4
Gene names (synonym ):PMP24
Gene names (ORF ):
Length:212
Mass:24264
Sequence:MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSLQEKLWAILQATYIHSWNLARFVFTYKGLRALQSYIQGKTYPAHAFLAAFLGGILVFGENNNINSQINMYLLSRVLFALSRLAVEKGYIPEPRWDPFPLLTAVVWGLVLWLFEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN
Tissue specificity:Expressed in normal prostate epithelial cells, and androgen-sensitive prostate adenocarcinoma cells. Not expressed in androgen-insensitive prostate adenocarcinoma cells. {ECO:0000269|PubMed:14712230}.
Induction:
Developmental stage:
Protein families:Peroxisomal membrane protein PXMP2/4 family