GKN1_HUMAN Q9NS71
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NS71
Recommended name：Gastrokine-1
EC number：
Alternative names：(18 kDa antrum mucosa protein) (AMP-18) (Protein CA11)
Cleaved into：
GeneID：56287
Gene names (primary )：GKN1
Gene names (synonym )：AMP18 CA11
Gene names (ORF )：UNQ489/PRO1005
Length：199
Mass：21999
Sequence：MLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Tissue specificity：Expressed in stomach. No expression is detected in cancer tissue or gastric cancer cell lines. {ECO:0000269|PubMed:10835488, ECO:0000269|PubMed:12851218}.
Induction：
Developmental stage：
Protein families：Gastrokine family