DHB14_HUMAN Q9BPX1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BPX1
Recommended name：L-fucose dehydrogenase
EC number：EC:1.1.1.122
Alternative names：(17-beta-hydroxysteroid dehydrogenase DHRS10) (Dehydrogenase/reductase SDR family member 10) (Retinal short-chain dehydrogenase/reductase retSDR3) (Short chain dehydrogenase/reductase family 47C member 1)
Cleaved into：
GeneID：51171
Gene names (primary )：HSD17B14
Gene names (synonym )：DHRS10 SDR3 SDR47C1
Gene names (ORF )：UNQ502/PRO474
Length：270
Mass：28317
Sequence：MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
Tissue specificity：Highly expressed in brain, placenta, liver and kidney. {ECO:0000269|PubMed:10800688, ECO:0000269|PubMed:17067289}.
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family