PEA15_HUMAN Q15121
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15121
Recommended name：Astrocytic phosphoprotein PEA-15
EC number：
Alternative names：(15 kDa phosphoprotein enriched in astrocytes) (Phosphoprotein enriched in diabetes) (PED)
Cleaved into：
GeneID：8682
Gene names (primary )：PEA15
Gene names (synonym )：
Gene names (ORF )：
Length：130
Mass：15040
Sequence：MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Tissue specificity：Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues from individuals with type 2 diabetes than in controls. {ECO:0000269|PubMed:9670003}.
Induction：
Developmental stage：
Protein families：