CRYA2_HUMAN   A0A140G945


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0A140G945

Recommended name:Alpha-crystallin A2 chain [Cleaved into: Alpha-crystallin A2

EC number:

Alternative names:(1-172); Alpha-crystallin A2(1-168); Alpha-crystallin A2(1-162)]

Cleaved into:Alpha-crystallin A2(1-172); Alpha-crystallin A2(1-168); Alpha-crystallin A2(1-162)

GeneID:102724652

Gene names  (primary ):CRYAA2

Gene names  (synonym ):CRYAA

Gene names  (ORF ):

Length:173

Mass:19909

Sequence:MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small heat shock protein (HSP20) family


   💬 WhatsApp