NSN5B_HUMAN   Q3KNT7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3KNT7

Recommended name:Putative NOL1/NOP2/Sun domain family member 5B

EC number:EC:2.1.1.-

Alternative names:(Williams-Beuren syndrome chromosomal region 20B protein)

Cleaved into:

GeneID:

Gene names  (primary ):NSUN5P1

Gene names  (synonym ):NSUN5B WBSCR20B

Gene names  (ORF ):

Length:163

Mass:17679

Sequence:MATLLAWVGVSCCELAEEDFLAVSPLDPRYREVHYVLLDPSCSGSGMPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVPDALQQNPGAFRLAPALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPT

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:12073013}.

Induction:

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, RsmB/NOP family


   💬 WhatsApp