VKOR1_HUMAN Q9BQB6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BQB6
Recommended name:Vitamin K epoxide reductase complex subunit 1
EC number:EC:1.17.4.4
Alternative names:(Vitamin K1 2,3-epoxide reductase subunit 1)
Cleaved into:
GeneID:79001
Gene names (primary ):VKORC1
Gene names (synonym ):VKOR
Gene names (ORF ):MSTP134 MSTP576 UNQ308/PRO351
Length:163
Mass:18235
Sequence:MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH
Tissue specificity:Expressed at highest levels in fetal and adult liver, followed by fetal heart, kidney, and lung, adult heart, and pancreas. {ECO:0000269|PubMed:14765194}.
Induction:
Developmental stage:
Protein families:VKOR family